Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for stomjoh 81. stomjoh Lv 1 15 pts. 8,621
  2. Avatar for SouperGenious 82. SouperGenious Lv 1 15 pts. 8,618
  3. Avatar for lynnai 83. lynnai Lv 1 15 pts. 8,617
  4. Avatar for Satina 84. Satina Lv 1 14 pts. 8,617
  5. Avatar for deLaCeiba 85. deLaCeiba Lv 1 14 pts. 8,609
  6. Avatar for guineapig 86. guineapig Lv 1 13 pts. 8,602
  7. Avatar for JUMELLE54 87. JUMELLE54 Lv 1 13 pts. 8,602
  8. Avatar for Jajaboman 88. Jajaboman Lv 1 13 pts. 8,598
  9. Avatar for Mike Lewis 89. Mike Lewis Lv 1 12 pts. 8,598
  10. Avatar for tallguy-13088 90. tallguy-13088 Lv 1 12 pts. 8,579

Comments