Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Ms. Carter's Jr. Science Classes 19. Ms. Carter's Jr. Science Classes 1 pt. 6,683
  10. Avatar for Deleted group 20. Deleted group pts. 6,575
  1. Avatar for pfirth 121. pfirth Lv 1 3 pts. 8,229
  2. Avatar for FreeFolder 122. FreeFolder Lv 1 3 pts. 8,229
  3. Avatar for mitarcher 123. mitarcher Lv 1 3 pts. 8,206
  4. Avatar for Jajaboman 124. Jajaboman Lv 1 3 pts. 8,204
  5. Avatar for Iron pet 125. Iron pet Lv 1 3 pts. 8,188
  6. Avatar for SouperGenious 126. SouperGenious Lv 1 3 pts. 8,179
  7. Avatar for aznarog 127. aznarog Lv 1 3 pts. 8,165
  8. Avatar for cherry39 128. cherry39 Lv 1 3 pts. 8,160
  9. Avatar for tela 129. tela Lv 1 2 pts. 8,148
  10. Avatar for senor pit 130. senor pit Lv 1 2 pts. 8,141

Comments