Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups


  1. Avatar for Contenders 100 pts. 9,220
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,140
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,095
  4. Avatar for Go Science 4. Go Science 49 pts. 9,051
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 37 pts. 9,029
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,028
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 8,935
  8. Avatar for Deleted group 8. Deleted group pts. 8,908
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,901
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,776

  1. Avatar for pfirth 121. pfirth Lv 1 3 pts. 8,229
  2. Avatar for FreeFolder 122. FreeFolder Lv 1 3 pts. 8,229
  3. Avatar for mitarcher 123. mitarcher Lv 1 3 pts. 8,206
  4. Avatar for Jajaboman 124. Jajaboman Lv 1 3 pts. 8,204
  5. Avatar for Iron pet 125. Iron pet Lv 1 3 pts. 8,188
  6. Avatar for SouperGenious 126. SouperGenious Lv 1 3 pts. 8,179
  7. Avatar for aznarog 127. aznarog Lv 1 3 pts. 8,165
  8. Avatar for cherry39 128. cherry39 Lv 1 3 pts. 8,160
  9. Avatar for tela 129. tela Lv 1 2 pts. 8,148
  10. Avatar for senor pit 130. senor pit Lv 1 2 pts. 8,141

Comments