Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Ms. Carter's Jr. Science Classes 19. Ms. Carter's Jr. Science Classes 1 pt. 6,683
  10. Avatar for Deleted group 20. Deleted group pts. 6,575
  1. Avatar for Lumir 181. Lumir Lv 1 1 pt. 7,384
  2. Avatar for DrTree 182. DrTree Lv 1 1 pt. 7,363
  3. Avatar for StpPls 183. StpPls Lv 1 1 pt. 7,342
  4. Avatar for Jaco van As 184. Jaco van As Lv 1 1 pt. 7,341
  5. Avatar for Philippe_C 185. Philippe_C Lv 1 1 pt. 7,274
  6. Avatar for marcuslelus 186. marcuslelus Lv 1 1 pt. 7,243
  7. Avatar for wh1357 187. wh1357 Lv 1 1 pt. 7,203
  8. Avatar for magmalm 188. magmalm Lv 1 1 pt. 7,049
  9. Avatar for Cnwill 189. Cnwill Lv 1 1 pt. 7,028
  10. Avatar for cnhrcolemam 190. cnhrcolemam Lv 1 1 pt. 6,780

Comments