Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Ms. Carter's Jr. Science Classes 19. Ms. Carter's Jr. Science Classes 1 pt. 6,683
  10. Avatar for Deleted group 20. Deleted group pts. 6,575
  1. Avatar for deLaCeiba 51. deLaCeiba Lv 1 31 pts. 8,776
  2. Avatar for tarimo 52. tarimo Lv 1 30 pts. 8,768
  3. Avatar for pvc78 53. pvc78 Lv 1 29 pts. 8,751
  4. Avatar for manu8170 54. manu8170 Lv 1 28 pts. 8,746
  5. Avatar for YGK 55. YGK Lv 1 28 pts. 8,726
  6. Avatar for andrewxc 56. andrewxc Lv 1 27 pts. 8,715
  7. Avatar for justjustin 57. justjustin Lv 1 26 pts. 8,709
  8. Avatar for Vinara 58. Vinara Lv 1 25 pts. 8,696
  9. Avatar for Satina 59. Satina Lv 1 25 pts. 8,692
  10. Avatar for cinnamonkitty 60. cinnamonkitty Lv 1 24 pts. 8,681

Comments