Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,220
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,140
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,095
  4. Avatar for Go Science 4. Go Science 49 pts. 9,051
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 37 pts. 9,029
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,028
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 8,935
  8. Avatar for Deleted group 8. Deleted group pts. 8,908
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,901
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,776
  1. Avatar for deLaCeiba 51. deLaCeiba Lv 1 31 pts. 8,776
  2. Avatar for tarimo 52. tarimo Lv 1 30 pts. 8,768
  3. Avatar for pvc78 53. pvc78 Lv 1 29 pts. 8,751
  4. Avatar for manu8170 54. manu8170 Lv 1 28 pts. 8,746
  5. Avatar for YGK 55. YGK Lv 1 28 pts. 8,726
  6. Avatar for andrewxc 56. andrewxc Lv 1 27 pts. 8,715
  7. Avatar for justjustin 57. justjustin Lv 1 26 pts. 8,709
  8. Avatar for Vinara 58. Vinara Lv 1 25 pts. 8,696
  9. Avatar for Satina 59. Satina Lv 1 25 pts. 8,692
  10. Avatar for cinnamonkitty 60. cinnamonkitty Lv 1 24 pts. 8,681

Comments