Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for YeshuaLives 131. YeshuaLives Lv 1 2 pts. 8,129
  2. Avatar for Virgo 132. Virgo Lv 1 2 pts. 8,127
  3. Avatar for froggs554 133. froggs554 Lv 1 2 pts. 8,107
  4. Avatar for BCAA 134. BCAA Lv 1 2 pts. 8,087
  5. Avatar for Inkedhands 135. Inkedhands Lv 1 2 pts. 8,069
  6. Avatar for lamoille 136. lamoille Lv 1 2 pts. 8,055
  7. Avatar for healyim 137. healyim Lv 1 2 pts. 8,046
  8. Avatar for nagistick 138. nagistick Lv 1 2 pts. 8,041
  9. Avatar for Jesse Pinkman 139. Jesse Pinkman Lv 1 2 pts. 8,032
  10. Avatar for dbuske 140. dbuske Lv 1 2 pts. 8,031

Comments