Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for evifnoskcaj 141. evifnoskcaj Lv 1 2 pts. 8,021
  2. Avatar for sean4046 142. sean4046 Lv 1 2 pts. 8,007
  3. Avatar for bitwave 143. bitwave Lv 1 1 pt. 7,989
  4. Avatar for metafolder 144. metafolder Lv 1 1 pt. 7,974
  5. Avatar for Merf 145. Merf Lv 1 1 pt. 7,962
  6. Avatar for momadoc 146. momadoc Lv 1 1 pt. 7,958
  7. Avatar for mirjamvandelft 147. mirjamvandelft Lv 1 1 pt. 7,893
  8. Avatar for Starlight36 148. Starlight36 Lv 1 1 pt. 7,884
  9. Avatar for ecali 149. ecali Lv 1 1 pt. 7,875
  10. Avatar for DScott 150. DScott Lv 1 1 pt. 7,861

Comments