Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for Close At Hand 171. Close At Hand Lv 1 1 pt. 7,602
  2. Avatar for pandapharmd 172. pandapharmd Lv 1 1 pt. 7,566
  3. Avatar for NeonNano 173. NeonNano Lv 1 1 pt. 7,556
  4. Avatar for tablular 174. tablular Lv 1 1 pt. 7,515
  5. Avatar for PrettyPony2001 175. PrettyPony2001 Lv 1 1 pt. 7,490
  6. Avatar for poploxelo 176. poploxelo Lv 1 1 pt. 7,481
  7. Avatar for isantheautumn 177. isantheautumn Lv 1 1 pt. 7,474
  8. Avatar for doyoumath 178. doyoumath Lv 1 1 pt. 7,446
  9. Avatar for johngran 179. johngran Lv 1 1 pt. 7,424
  10. Avatar for emdee314 180. emdee314 Lv 1 1 pt. 7,399

Comments