Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for pandabearsecond 191. pandabearsecond Lv 1 1 pt. 6,765
  2. Avatar for Arne Heessels 192. Arne Heessels Lv 1 1 pt. 6,763
  3. Avatar for penteplayer 193. penteplayer Lv 1 1 pt. 6,750
  4. Avatar for FrozenInCarbonite 194. FrozenInCarbonite Lv 1 1 pt. 6,735
  5. Avatar for ChaseLehr1234 195. ChaseLehr1234 Lv 1 1 pt. 6,683
  6. Avatar for Altejos349 196. Altejos349 Lv 1 1 pt. 6,667
  7. Avatar for mccannm 197. mccannm Lv 1 1 pt. 6,655
  8. Avatar for Michaelb1029384 198. Michaelb1029384 Lv 1 1 pt. 6,636
  9. Avatar for rezaefar 199. rezaefar Lv 1 1 pt. 6,633
  10. Avatar for FreyrH 200. FreyrH Lv 1 1 pt. 6,619

Comments