Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for Shannon Aga 211. Shannon Aga Lv 1 1 pt. 6,263
  2. Avatar for Schleicher 212. Schleicher Lv 1 1 pt. 6,263
  3. Avatar for Odog319 213. Odog319 Lv 1 1 pt. 6,259
  4. Avatar for CubicB 214. CubicB Lv 1 1 pt. 6,150
  5. Avatar for bgrassy 215. bgrassy Lv 1 1 pt. 6,008
  6. Avatar for UnclePeeH 216. UnclePeeH Lv 1 1 pt. 5,945
  7. Avatar for JellyfishCoder 217. JellyfishCoder Lv 1 1 pt. 5,546
  8. Avatar for DrakeSnarski 218. DrakeSnarski Lv 1 1 pt. 4,841
  9. Avatar for meburke 219. meburke Lv 1 1 pt. 4,840
  10. Avatar for aspadistra 220. aspadistra Lv 1 1 pt. 4,595

Comments