Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for JCBio162 221. JCBio162 Lv 1 1 pt. 0
  2. Avatar for Soweli 222. Soweli Lv 1 1 pt. 0
  3. Avatar for bob1928 223. bob1928 Lv 1 1 pt. 0
  4. Avatar for BeckerM 224. BeckerM Lv 1 1 pt. 0
  5. Avatar for Mike Cassidy 225. Mike Cassidy Lv 1 1 pt. 0
  6. Avatar for crpainter 226. crpainter Lv 1 1 pt. 0
  7. Avatar for affecaffe 227. affecaffe Lv 1 1 pt. 0
  8. Avatar for atlas100 228. atlas100 Lv 1 1 pt. 0
  9. Avatar for petetrig 229. petetrig Lv 1 1 pt. 0
  10. Avatar for ivalnic 230. ivalnic Lv 1 1 pt. 0

Comments