Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for ivalnic 231. ivalnic Lv 1 1 pt. 0
  2. Avatar for hada 232. hada Lv 1 1 pt. 0
  3. Avatar for jebbiek 233. jebbiek Lv 1 1 pt. 0
  4. Avatar for packer 234. packer Lv 1 1 pt. 0
  5. Avatar for JackONeill12 235. JackONeill12 Lv 1 1 pt. 0
  6. Avatar for innatan221 236. innatan221 Lv 1 1 pt. 0

Comments