Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 40 pts. 8,868
  2. Avatar for dcrwheeler 42. dcrwheeler Lv 1 39 pts. 8,860
  3. Avatar for Skippysk8s 43. Skippysk8s Lv 1 38 pts. 8,854
  4. Avatar for lynnai 44. lynnai Lv 1 37 pts. 8,832
  5. Avatar for diamond_dust 45. diamond_dust Lv 1 36 pts. 8,831
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 35 pts. 8,811
  7. Avatar for Deleted player 47. Deleted player 34 pts. 8,798
  8. Avatar for pmdpmd 48. pmdpmd Lv 1 33 pts. 8,784
  9. Avatar for uhuuhu 49. uhuuhu Lv 1 32 pts. 8,778
  10. Avatar for alcor29 50. alcor29 Lv 1 32 pts. 8,777

Comments