Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for Mike Lewis 61. Mike Lewis Lv 1 23 pts. 8,659
  2. Avatar for Bushman 62. Bushman Lv 1 23 pts. 8,659
  3. Avatar for ViJay7019 63. ViJay7019 Lv 1 22 pts. 8,650
  4. Avatar for goastano 64. goastano Lv 1 22 pts. 8,648
  5. Avatar for ManVsYard 65. ManVsYard Lv 1 21 pts. 8,643
  6. Avatar for bx7gn 66. bx7gn Lv 1 20 pts. 8,641
  7. Avatar for dpmattingly 67. dpmattingly Lv 1 20 pts. 8,634
  8. Avatar for benrh 68. benrh Lv 1 19 pts. 8,634
  9. Avatar for hansvandenhof 69. hansvandenhof Lv 1 19 pts. 8,624
  10. Avatar for bendbob 70. bendbob Lv 1 18 pts. 8,619

Comments