Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for Giant Berk 71. Giant Berk Lv 1 18 pts. 8,615
  2. Avatar for caglar 72. caglar Lv 1 17 pts. 8,614
  3. Avatar for opiorfina 73. opiorfina Lv 1 17 pts. 8,613
  4. Avatar for cbwest 74. cbwest Lv 1 16 pts. 8,611
  5. Avatar for harvardman 75. harvardman Lv 1 16 pts. 8,604
  6. Avatar for WarpSpeed 76. WarpSpeed Lv 1 15 pts. 8,583
  7. Avatar for WBarme1234 77. WBarme1234 Lv 1 15 pts. 8,569
  8. Avatar for smilingone 78. smilingone Lv 1 14 pts. 8,561
  9. Avatar for jamiexq 79. jamiexq Lv 1 14 pts. 8,556
  10. Avatar for Mr_Jolty 80. Mr_Jolty Lv 1 13 pts. 8,556

Comments