Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for xkcd 11. xkcd 4 pts. 8,902
  2. Avatar for freefolder 12. freefolder 3 pts. 8,883
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,554
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,494
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,388
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,329
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,252
  8. Avatar for Russian team 18. Russian team 1 pt. 8,033
  9. Avatar for Deleted group 19. Deleted group pts. 7,955
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,312
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,515
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 98 pts. 9,504
  3. Avatar for Mark- 3. Mark- Lv 1 96 pts. 9,493
  4. Avatar for Galaxie 4. Galaxie Lv 1 94 pts. 9,476
  5. Avatar for WarpSpeed 5. WarpSpeed Lv 1 92 pts. 9,463
  6. Avatar for bertro 6. bertro Lv 1 90 pts. 9,457
  7. Avatar for gmn 7. gmn Lv 1 88 pts. 9,453
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 86 pts. 9,437
  9. Avatar for Susume 9. Susume Lv 1 84 pts. 9,435
  10. Avatar for diamond_dust 10. diamond_dust Lv 1 82 pts. 9,429

Comments