Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,515
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 98 pts. 9,504
  3. Avatar for Mark- 3. Mark- Lv 1 96 pts. 9,493
  4. Avatar for Galaxie 4. Galaxie Lv 1 94 pts. 9,476
  5. Avatar for WarpSpeed 5. WarpSpeed Lv 1 92 pts. 9,463
  6. Avatar for bertro 6. bertro Lv 1 90 pts. 9,457
  7. Avatar for gmn 7. gmn Lv 1 88 pts. 9,453
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 86 pts. 9,437
  9. Avatar for Susume 9. Susume Lv 1 84 pts. 9,435
  10. Avatar for diamond_dust 10. diamond_dust Lv 1 82 pts. 9,429

Comments