Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups


  1. Avatar for xkcd 11. xkcd 4 pts. 8,902
  2. Avatar for freefolder 12. freefolder 3 pts. 8,883
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,554
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,494
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,388
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,329
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,252
  8. Avatar for Russian team 18. Russian team 1 pt. 8,033
  9. Avatar for Deleted group 19. Deleted group pts. 7,955
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,312

  1. Avatar for manu8170 101. manu8170 Lv 1 6 pts. 8,746
  2. Avatar for guineapig 102. guineapig Lv 1 5 pts. 8,744
  3. Avatar for arginia 103. arginia Lv 1 5 pts. 8,739
  4. Avatar for Festering Wounds 104. Festering Wounds Lv 1 5 pts. 8,736
  5. Avatar for senor pit 105. senor pit Lv 1 5 pts. 8,723
  6. Avatar for SKSbell 106. SKSbell Lv 1 5 pts. 8,718
  7. Avatar for Mike Cassidy 107. Mike Cassidy Lv 1 4 pts. 8,695
  8. Avatar for rg_sar 108. rg_sar Lv 1 4 pts. 8,690
  9. Avatar for tallguy-13088 109. tallguy-13088 Lv 1 4 pts. 8,684
  10. Avatar for Jim Fraser 110. Jim Fraser Lv 1 4 pts. 8,679

Comments