Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for xkcd 11. xkcd 4 pts. 8,902
  2. Avatar for freefolder 12. freefolder 3 pts. 8,883
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,554
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,494
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,388
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,329
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,252
  8. Avatar for Russian team 18. Russian team 1 pt. 8,033
  9. Avatar for Deleted group 19. Deleted group pts. 7,955
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,312
  1. Avatar for iasok 201. iasok Lv 1 1 pt. 5,955
  2. Avatar for Elunet 202. Elunet Lv 1 1 pt. 5,757
  3. Avatar for elyas10 203. elyas10 Lv 1 1 pt. 5,679
  4. Avatar for eline.h 204. eline.h Lv 1 1 pt. 5,661
  5. Avatar for Close At Hand 205. Close At Hand Lv 1 1 pt. 5,454
  6. Avatar for marie.c 206. marie.c Lv 1 1 pt. 5,452
  7. Avatar for Tiger54 207. Tiger54 Lv 1 1 pt. 5,087
  8. Avatar for mati_ 208. mati_ Lv 1 1 pt. 4,902
  9. Avatar for Orang3FoXx 209. Orang3FoXx Lv 1 1 pt. 3,630
  10. Avatar for affecaffe 210. affecaffe Lv 1 1 pt. 0

Comments