Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for xkcd 11. xkcd 4 pts. 8,902
  2. Avatar for freefolder 12. freefolder 3 pts. 8,883
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,554
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,494
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,388
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,329
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,252
  8. Avatar for Russian team 18. Russian team 1 pt. 8,033
  9. Avatar for Deleted group 19. Deleted group pts. 7,955
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,312
  1. Avatar for fishercat 81. fishercat Lv 1 11 pts. 8,906
  2. Avatar for fryguy 82. fryguy Lv 1 11 pts. 8,902
  3. Avatar for Bushman 83. Bushman Lv 1 10 pts. 8,900
  4. Avatar for decbin 84. decbin Lv 1 10 pts. 8,897
  5. Avatar for hpaege 85. hpaege Lv 1 10 pts. 8,892
  6. Avatar for georg137 86. georg137 Lv 1 9 pts. 8,890
  7. Avatar for YeshuaLives 87. YeshuaLives Lv 1 9 pts. 8,889
  8. Avatar for Altercomp 88. Altercomp Lv 1 9 pts. 8,883
  9. Avatar for dpmattingly 89. dpmattingly Lv 1 9 pts. 8,879
  10. Avatar for Vinara 90. Vinara Lv 1 8 pts. 8,861

Comments