Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 6,985

  1. Avatar for diamonddays 121. diamonddays Lv 1 3 pts. 8,504
  2. Avatar for Yagus 122. Yagus Lv 1 2 pts. 8,504
  3. Avatar for BCAA 123. BCAA Lv 1 2 pts. 8,494
  4. Avatar for demeter900 124. demeter900 Lv 1 2 pts. 8,483
  5. Avatar for Deleted player 125. Deleted player pts. 8,473
  6. Avatar for pfirth 126. pfirth Lv 1 2 pts. 8,439
  7. Avatar for dahast.de 127. dahast.de Lv 1 2 pts. 8,434
  8. Avatar for 01010011111 128. 01010011111 Lv 1 2 pts. 8,408
  9. Avatar for SouperGenious 129. SouperGenious Lv 1 2 pts. 8,408
  10. Avatar for bhodg1 130. bhodg1 Lv 1 2 pts. 8,396

Comments