Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for Arne Heessels 131. Arne Heessels Lv 1 2 pts. 8,394
  2. Avatar for kitek314_pl 132. kitek314_pl Lv 1 2 pts. 8,388
  3. Avatar for Inkedhands 133. Inkedhands Lv 1 2 pts. 8,387
  4. Avatar for tela 134. tela Lv 1 2 pts. 8,374
  5. Avatar for martin.szew 135. martin.szew Lv 1 1 pt. 8,373
  6. Avatar for lacie 136. lacie Lv 1 1 pt. 8,350
  7. Avatar for martinf 137. martinf Lv 1 1 pt. 8,339
  8. Avatar for RyeSnake 138. RyeSnake Lv 1 1 pt. 8,330
  9. Avatar for doctaven 139. doctaven Lv 1 1 pt. 8,329
  10. Avatar for dbuske 140. dbuske Lv 1 1 pt. 8,303

Comments