Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for LociOiling 11. LociOiling Lv 1 80 pts. 9,426
  2. Avatar for Scopper 12. Scopper Lv 1 78 pts. 9,420
  3. Avatar for Museka 13. Museka Lv 1 76 pts. 9,419
  4. Avatar for alcor29 14. alcor29 Lv 1 74 pts. 9,404
  5. Avatar for Deleted player 15. Deleted player pts. 9,402
  6. Avatar for Terafold 16. Terafold Lv 1 71 pts. 9,393
  7. Avatar for bendbob 17. bendbob Lv 1 69 pts. 9,388
  8. Avatar for mimi 18. mimi Lv 1 68 pts. 9,383
  9. Avatar for Skippysk8s 19. Skippysk8s Lv 1 66 pts. 9,366
  10. Avatar for gloverd 20. gloverd Lv 1 64 pts. 9,355

Comments