Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for iasok 201. iasok Lv 1 1 pt. 5,955
  2. Avatar for Elunet 202. Elunet Lv 1 1 pt. 5,757
  3. Avatar for elyas10 203. elyas10 Lv 1 1 pt. 5,679
  4. Avatar for eline.h 204. eline.h Lv 1 1 pt. 5,661
  5. Avatar for Close At Hand 205. Close At Hand Lv 1 1 pt. 5,454
  6. Avatar for marie.c 206. marie.c Lv 1 1 pt. 5,452
  7. Avatar for Tiger54 207. Tiger54 Lv 1 1 pt. 5,087
  8. Avatar for mati_ 208. mati_ Lv 1 1 pt. 4,902
  9. Avatar for Orang3FoXx 209. Orang3FoXx Lv 1 1 pt. 3,630
  10. Avatar for affecaffe 210. affecaffe Lv 1 1 pt. 0

Comments