Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for lamdan 211. lamdan Lv 1 1 pt. 0
  2. Avatar for Hackney 212. Hackney Lv 1 1 pt. 0
  3. Avatar for petetrig 213. petetrig Lv 1 1 pt. 0
  4. Avatar for dettingen 214. dettingen Lv 1 1 pt. 0
  5. Avatar for DNA-RNA 215. DNA-RNA Lv 1 1 pt. 0
  6. Avatar for packer 216. packer Lv 1 1 pt. 0
  7. Avatar for UNail 217. UNail Lv 1 1 pt. 0
  8. Avatar for kas_s 218. kas_s Lv 1 1 pt. 0
  9. Avatar for meatexplosion 219. meatexplosion Lv 1 1 pt. 0
  10. Avatar for sheerbliss 220. sheerbliss Lv 1 1 pt. 0

Comments