Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for BrKapr 21. BrKapr Lv 1 63 pts. 9,349
  2. Avatar for jermainiac 22. jermainiac Lv 1 61 pts. 9,344
  3. Avatar for TomTaylor 23. TomTaylor Lv 1 60 pts. 9,338
  4. Avatar for KarenCH 24. KarenCH Lv 1 58 pts. 9,335
  5. Avatar for dcrwheeler 25. dcrwheeler Lv 1 57 pts. 9,322
  6. Avatar for pauldunn 26. pauldunn Lv 1 56 pts. 9,316
  7. Avatar for spvincent 27. spvincent Lv 1 54 pts. 9,316
  8. Avatar for notius 28. notius Lv 1 53 pts. 9,314
  9. Avatar for Bletchley Park 29. Bletchley Park Lv 1 51 pts. 9,300
  10. Avatar for actiasluna 30. actiasluna Lv 1 50 pts. 9,298

Comments