Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for Madde 31. Madde Lv 1 49 pts. 9,294
  2. Avatar for MurloW 32. MurloW Lv 1 48 pts. 9,291
  3. Avatar for Blipperman 33. Blipperman Lv 1 46 pts. 9,290
  4. Avatar for nicobul 34. nicobul Lv 1 45 pts. 9,287
  5. Avatar for O Seki To 35. O Seki To Lv 1 44 pts. 9,282
  6. Avatar for gitwut 36. gitwut Lv 1 43 pts. 9,281
  7. Avatar for johnmitch 37. johnmitch Lv 1 42 pts. 9,280
  8. Avatar for justjustin 38. justjustin Lv 1 41 pts. 9,275
  9. Avatar for reefyrob 39. reefyrob Lv 1 40 pts. 9,270
  10. Avatar for nemo7731 40. nemo7731 Lv 1 39 pts. 9,269

Comments