Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for harvardman 71. harvardman Lv 1 16 pts. 8,967
  2. Avatar for alwen 72. alwen Lv 1 15 pts. 8,964
  3. Avatar for Deleted player 73. Deleted player 15 pts. 8,957
  4. Avatar for ViJay7019 74. ViJay7019 Lv 1 14 pts. 8,941
  5. Avatar for stomjoh 75. stomjoh Lv 1 14 pts. 8,941
  6. Avatar for hansvandenhof 76. hansvandenhof Lv 1 13 pts. 8,936
  7. Avatar for metafolder 77. metafolder Lv 1 13 pts. 8,928
  8. Avatar for Flagg65a 78. Flagg65a Lv 1 12 pts. 8,921
  9. Avatar for YGK 79. YGK Lv 1 12 pts. 8,916
  10. Avatar for weitzen 80. weitzen Lv 1 12 pts. 8,910

Comments