Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 6,985

  1. Avatar for fishercat 81. fishercat Lv 1 11 pts. 8,906
  2. Avatar for fryguy 82. fryguy Lv 1 11 pts. 8,902
  3. Avatar for Bushman 83. Bushman Lv 1 10 pts. 8,900
  4. Avatar for decbin 84. decbin Lv 1 10 pts. 8,897
  5. Avatar for hpaege 85. hpaege Lv 1 10 pts. 8,892
  6. Avatar for georg137 86. georg137 Lv 1 9 pts. 8,890
  7. Avatar for YeshuaLives 87. YeshuaLives Lv 1 9 pts. 8,889
  8. Avatar for Altercomp 88. Altercomp Lv 1 9 pts. 8,883
  9. Avatar for dpmattingly 89. dpmattingly Lv 1 9 pts. 8,879
  10. Avatar for Vinara 90. Vinara Lv 1 8 pts. 8,861

Comments