Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups


  1. Avatar for Go Science 100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060

  1. Avatar for ManVsYard 91. ManVsYard Lv 1 8 pts. 8,845
  2. Avatar for Alistair69 92. Alistair69 Lv 1 8 pts. 8,834
  3. Avatar for Hansie 93. Hansie Lv 1 7 pts. 8,834
  4. Avatar for Iron pet 94. Iron pet Lv 1 7 pts. 8,830
  5. Avatar for ecali 95. ecali Lv 1 7 pts. 8,800
  6. Avatar for navn 96. navn Lv 1 7 pts. 8,786
  7. Avatar for JUMELLE54 97. JUMELLE54 Lv 1 6 pts. 8,785
  8. Avatar for Bautho 98. Bautho Lv 1 6 pts. 8,780
  9. Avatar for TJOK fan 99. TJOK fan Lv 1 6 pts. 8,762
  10. Avatar for t012 100. t012 Lv 1 6 pts. 8,751

Comments