Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups


  1. Avatar for Go Science 100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060

  1. Avatar for manu8170 101. manu8170 Lv 1 6 pts. 8,746
  2. Avatar for guineapig 102. guineapig Lv 1 5 pts. 8,744
  3. Avatar for arginia 103. arginia Lv 1 5 pts. 8,739
  4. Avatar for Festering Wounds 104. Festering Wounds Lv 1 5 pts. 8,736
  5. Avatar for senor pit 105. senor pit Lv 1 5 pts. 8,723
  6. Avatar for SKSbell 106. SKSbell Lv 1 5 pts. 8,718
  7. Avatar for Mike Cassidy 107. Mike Cassidy Lv 1 4 pts. 8,695
  8. Avatar for rg_sar 108. rg_sar Lv 1 4 pts. 8,690
  9. Avatar for tallguy-13088 109. tallguy-13088 Lv 1 4 pts. 8,684
  10. Avatar for Jim Fraser 110. Jim Fraser Lv 1 4 pts. 8,679

Comments