Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups


  1. Avatar for Go Science 100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060

  1. Avatar for diamonddays 121. diamonddays Lv 1 3 pts. 8,504
  2. Avatar for Yagus 122. Yagus Lv 1 2 pts. 8,504
  3. Avatar for BCAA 123. BCAA Lv 1 2 pts. 8,494
  4. Avatar for demeter900 124. demeter900 Lv 1 2 pts. 8,483
  5. Avatar for Deleted player 125. Deleted player pts. 8,473
  6. Avatar for pfirth 126. pfirth Lv 1 2 pts. 8,439
  7. Avatar for dahast.de 127. dahast.de Lv 1 2 pts. 8,434
  8. Avatar for 01010011111 128. 01010011111 Lv 1 2 pts. 8,408
  9. Avatar for SouperGenious 129. SouperGenious Lv 1 2 pts. 8,408
  10. Avatar for bhodg1 130. bhodg1 Lv 1 2 pts. 8,396

Comments