Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups


  1. Avatar for Go Science 100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060

  1. Avatar for Arne Heessels 131. Arne Heessels Lv 1 2 pts. 8,394
  2. Avatar for kitek314_pl 132. kitek314_pl Lv 1 2 pts. 8,388
  3. Avatar for Inkedhands 133. Inkedhands Lv 1 2 pts. 8,387
  4. Avatar for tela 134. tela Lv 1 2 pts. 8,374
  5. Avatar for martin.szew 135. martin.szew Lv 1 1 pt. 8,373
  6. Avatar for lacie 136. lacie Lv 1 1 pt. 8,350
  7. Avatar for martinf 137. martinf Lv 1 1 pt. 8,339
  8. Avatar for RyeSnake 138. RyeSnake Lv 1 1 pt. 8,330
  9. Avatar for doctaven 139. doctaven Lv 1 1 pt. 8,329
  10. Avatar for dbuske 140. dbuske Lv 1 1 pt. 8,303

Comments