Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060
  1. Avatar for Psych0Active 171. Psych0Active Lv 1 1 pt. 7,749
  2. Avatar for bwkittitas 172. bwkittitas Lv 1 1 pt. 7,741
  3. Avatar for 17581249_Juries 173. 17581249_Juries Lv 1 1 pt. 7,706
  4. Avatar for MaartenDesnouck 174. MaartenDesnouck Lv 1 1 pt. 7,665
  5. Avatar for jebbiek 175. jebbiek Lv 1 1 pt. 7,619
  6. Avatar for cherry39 176. cherry39 Lv 1 1 pt. 7,572
  7. Avatar for Sydefecks 177. Sydefecks Lv 1 1 pt. 7,514
  8. Avatar for DrTree 178. DrTree Lv 1 1 pt. 7,426
  9. Avatar for Tac1 179. Tac1 Lv 1 1 pt. 7,388
  10. Avatar for aspadistra 180. aspadistra Lv 1 1 pt. 7,312

Comments