Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for JUMELLE54 91. JUMELLE54 Lv 1 11 pts. 8,701
  2. Avatar for NameChangeNeeded01 92. NameChangeNeeded01 Lv 1 11 pts. 8,692
  3. Avatar for ManVsYard 93. ManVsYard Lv 1 11 pts. 8,692
  4. Avatar for ivalnic 94. ivalnic Lv 1 10 pts. 8,685
  5. Avatar for Pro Lapser 95. Pro Lapser Lv 1 10 pts. 8,661
  6. Avatar for Bushman 96. Bushman Lv 1 10 pts. 8,654
  7. Avatar for georg137 97. georg137 Lv 1 9 pts. 8,652
  8. Avatar for fiendish_ghoul 98. fiendish_ghoul Lv 1 9 pts. 8,632
  9. Avatar for deLaCeiba 99. deLaCeiba Lv 1 9 pts. 8,629
  10. Avatar for bx7gn 100. bx7gn Lv 1 9 pts. 8,628

Comments