Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,421
  2. Avatar for Go Science 2. Go Science 84 pts. 9,416
  3. Avatar for Contenders 3. Contenders 70 pts. 9,374
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 58 pts. 9,335
  5. Avatar for Beta Folders 5. Beta Folders 48 pts. 9,324
  6. Avatar for HMT heritage 6. HMT heritage 39 pts. 9,277
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 32 pts. 9,210
  8. Avatar for Void Crushers 8. Void Crushers 26 pts. 9,173
  9. Avatar for Deleted group 9. Deleted group pts. 9,060
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 16 pts. 8,870
  1. Avatar for JUMELLE54 91. JUMELLE54 Lv 1 11 pts. 8,701
  2. Avatar for NameChangeNeeded01 92. NameChangeNeeded01 Lv 1 11 pts. 8,692
  3. Avatar for ManVsYard 93. ManVsYard Lv 1 11 pts. 8,692
  4. Avatar for ivalnic 94. ivalnic Lv 1 10 pts. 8,685
  5. Avatar for Pro Lapser 95. Pro Lapser Lv 1 10 pts. 8,661
  6. Avatar for Bushman 96. Bushman Lv 1 10 pts. 8,654
  7. Avatar for georg137 97. georg137 Lv 1 9 pts. 8,652
  8. Avatar for fiendish_ghoul 98. fiendish_ghoul Lv 1 9 pts. 8,632
  9. Avatar for deLaCeiba 99. deLaCeiba Lv 1 9 pts. 8,629
  10. Avatar for bx7gn 100. bx7gn Lv 1 9 pts. 8,628

Comments