Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for ecali 111. ecali Lv 1 6 pts. 8,525
  2. Avatar for Deleted player 112. Deleted player pts. 8,515
  3. Avatar for Psych0Active 113. Psych0Active Lv 1 6 pts. 8,515
  4. Avatar for Superphosphate 114. Superphosphate Lv 1 5 pts. 8,497
  5. Avatar for Altercomp 115. Altercomp Lv 1 5 pts. 8,478
  6. Avatar for teraflop 116. teraflop Lv 1 5 pts. 8,466
  7. Avatar for Mike Cassidy 117. Mike Cassidy Lv 1 5 pts. 8,463
  8. Avatar for t012 118. t012 Lv 1 5 pts. 8,462
  9. Avatar for Iron pet 119. Iron pet Lv 1 5 pts. 8,458
  10. Avatar for bcd 120. bcd Lv 1 4 pts. 8,433

Comments