Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,421
  2. Avatar for Go Science 2. Go Science 84 pts. 9,416
  3. Avatar for Contenders 3. Contenders 70 pts. 9,374
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 58 pts. 9,335
  5. Avatar for Beta Folders 5. Beta Folders 48 pts. 9,324
  6. Avatar for HMT heritage 6. HMT heritage 39 pts. 9,277
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 32 pts. 9,210
  8. Avatar for Void Crushers 8. Void Crushers 26 pts. 9,173
  9. Avatar for Deleted group 9. Deleted group pts. 9,060
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 16 pts. 8,870
  1. Avatar for ecali 111. ecali Lv 1 6 pts. 8,525
  2. Avatar for Deleted player 112. Deleted player pts. 8,515
  3. Avatar for Psych0Active 113. Psych0Active Lv 1 6 pts. 8,515
  4. Avatar for Superphosphate 114. Superphosphate Lv 1 5 pts. 8,497
  5. Avatar for Altercomp 115. Altercomp Lv 1 5 pts. 8,478
  6. Avatar for teraflop 116. teraflop Lv 1 5 pts. 8,466
  7. Avatar for Mike Cassidy 117. Mike Cassidy Lv 1 5 pts. 8,463
  8. Avatar for t012 118. t012 Lv 1 5 pts. 8,462
  9. Avatar for Iron pet 119. Iron pet Lv 1 5 pts. 8,458
  10. Avatar for bcd 120. bcd Lv 1 4 pts. 8,433

Comments