Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for jobo0502 41. jobo0502 Lv 1 42 pts. 9,126
  2. Avatar for gitwut 42. gitwut Lv 1 41 pts. 9,113
  3. Avatar for Skippysk8s 43. Skippysk8s Lv 1 40 pts. 9,092
  4. Avatar for Blipperman 44. Blipperman Lv 1 39 pts. 9,081
  5. Avatar for johnmitch 45. johnmitch Lv 1 38 pts. 9,067
  6. Avatar for Madde 46. Madde Lv 1 38 pts. 9,062
  7. Avatar for hansvandenhof 47. hansvandenhof Lv 1 37 pts. 9,062
  8. Avatar for drumpeter18yrs9yrs 48. drumpeter18yrs9yrs Lv 1 36 pts. 9,060
  9. Avatar for g_b 49. g_b Lv 1 35 pts. 9,054
  10. Avatar for Anfinsen_slept_here 50. Anfinsen_slept_here Lv 1 34 pts. 9,054

Comments