Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 22. Deleted group pts. 6,999
  2. Avatar for Deleted group 24. Deleted group pts. 6,740
  3. Avatar for Team South Africa 25. Team South Africa 1 pt. 6,493
  4. Avatar for USD_IMB 27. USD_IMB 1 pt. 5,955
  5. Avatar for Something Witty 28. Something Witty 1 pt. 5,770
  6. Avatar for Rechenkraft.net 29. Rechenkraft.net 1 pt. 5,130
  7. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 0

  1. Avatar for JUMELLE54 91. JUMELLE54 Lv 1 11 pts. 8,701
  2. Avatar for NameChangeNeeded01 92. NameChangeNeeded01 Lv 1 11 pts. 8,692
  3. Avatar for ManVsYard 93. ManVsYard Lv 1 11 pts. 8,692
  4. Avatar for ivalnic 94. ivalnic Lv 1 10 pts. 8,685
  5. Avatar for Pro Lapser 95. Pro Lapser Lv 1 10 pts. 8,661
  6. Avatar for Bushman 96. Bushman Lv 1 10 pts. 8,654
  7. Avatar for georg137 97. georg137 Lv 1 9 pts. 8,652
  8. Avatar for fiendish_ghoul 98. fiendish_ghoul Lv 1 9 pts. 8,632
  9. Avatar for deLaCeiba 99. deLaCeiba Lv 1 9 pts. 8,629
  10. Avatar for bx7gn 100. bx7gn Lv 1 9 pts. 8,628

Comments