Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 22. Deleted group pts. 6,999
  2. Avatar for Deleted group 24. Deleted group pts. 6,740
  3. Avatar for Team South Africa 25. Team South Africa 1 pt. 6,493
  4. Avatar for USD_IMB 27. USD_IMB 1 pt. 5,955
  5. Avatar for Something Witty 28. Something Witty 1 pt. 5,770
  6. Avatar for Rechenkraft.net 29. Rechenkraft.net 1 pt. 5,130
  7. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 0

  1. Avatar for Inkedhands 101. Inkedhands Lv 1 8 pts. 8,627
  2. Avatar for Marvelz 102. Marvelz Lv 1 8 pts. 8,623
  3. Avatar for pfirth 103. pfirth Lv 1 8 pts. 8,602
  4. Avatar for weitzen 104. weitzen Lv 1 8 pts. 8,593
  5. Avatar for BCAA 105. BCAA Lv 1 7 pts. 8,585
  6. Avatar for smholst 106. smholst Lv 1 7 pts. 8,581
  7. Avatar for Mr_Jolty 107. Mr_Jolty Lv 1 7 pts. 8,568
  8. Avatar for arginia 108. arginia Lv 1 7 pts. 8,562
  9. Avatar for stomjoh 109. stomjoh Lv 1 6 pts. 8,561
  10. Avatar for Schleicher 110. Schleicher Lv 1 6 pts. 8,542

Comments