Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,421
  2. Avatar for Go Science 2. Go Science 84 pts. 9,416
  3. Avatar for Contenders 3. Contenders 70 pts. 9,374
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 58 pts. 9,335
  5. Avatar for Beta Folders 5. Beta Folders 48 pts. 9,324
  6. Avatar for HMT heritage 6. HMT heritage 39 pts. 9,277
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 32 pts. 9,210
  8. Avatar for Void Crushers 8. Void Crushers 26 pts. 9,173
  9. Avatar for Deleted group 9. Deleted group pts. 9,060
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 16 pts. 8,870
  1. Avatar for Inkedhands 101. Inkedhands Lv 1 8 pts. 8,627
  2. Avatar for Marvelz 102. Marvelz Lv 1 8 pts. 8,623
  3. Avatar for pfirth 103. pfirth Lv 1 8 pts. 8,602
  4. Avatar for weitzen 104. weitzen Lv 1 8 pts. 8,593
  5. Avatar for BCAA 105. BCAA Lv 1 7 pts. 8,585
  6. Avatar for smholst 106. smholst Lv 1 7 pts. 8,581
  7. Avatar for Mr_Jolty 107. Mr_Jolty Lv 1 7 pts. 8,568
  8. Avatar for arginia 108. arginia Lv 1 7 pts. 8,562
  9. Avatar for stomjoh 109. stomjoh Lv 1 6 pts. 8,561
  10. Avatar for Schleicher 110. Schleicher Lv 1 6 pts. 8,542

Comments