Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 22. Deleted group pts. 6,999
  2. Avatar for Deleted group 24. Deleted group pts. 6,740
  3. Avatar for Team South Africa 25. Team South Africa 1 pt. 6,493
  4. Avatar for USD_IMB 27. USD_IMB 1 pt. 5,955
  5. Avatar for Something Witty 28. Something Witty 1 pt. 5,770
  6. Avatar for Rechenkraft.net 29. Rechenkraft.net 1 pt. 5,130
  7. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 0

  1. Avatar for ecali 111. ecali Lv 1 6 pts. 8,525
  2. Avatar for Deleted player 112. Deleted player pts. 8,515
  3. Avatar for Psych0Active 113. Psych0Active Lv 1 6 pts. 8,515
  4. Avatar for Superphosphate 114. Superphosphate Lv 1 5 pts. 8,497
  5. Avatar for Altercomp 115. Altercomp Lv 1 5 pts. 8,478
  6. Avatar for teraflop 116. teraflop Lv 1 5 pts. 8,466
  7. Avatar for Mike Cassidy 117. Mike Cassidy Lv 1 5 pts. 8,463
  8. Avatar for t012 118. t012 Lv 1 5 pts. 8,462
  9. Avatar for Iron pet 119. Iron pet Lv 1 5 pts. 8,458
  10. Avatar for bcd 120. bcd Lv 1 4 pts. 8,433

Comments