Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Piratenpartei Deutschland 21. Piratenpartei Deutschland 1 pt. 7,160
  2. Avatar for Deleted group 22. Deleted group pts. 6,999
  3. Avatar for Dr. Short's Molecular Lab 23. Dr. Short's Molecular Lab 1 pt. 6,994
  4. Avatar for Deleted group 24. Deleted group pts. 6,740
  5. Avatar for Team South Africa 25. Team South Africa 1 pt. 6,493
  6. Avatar for Ms. Carter's Jr. Science Classes 26. Ms. Carter's Jr. Science Classes 1 pt. 5,959
  7. Avatar for USD_IMB 27. USD_IMB 1 pt. 5,955
  8. Avatar for Something Witty 28. Something Witty 1 pt. 5,770
  9. Avatar for Rechenkraft.net 29. Rechenkraft.net 1 pt. 5,130
  10. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 0
  1. Avatar for jobo0502 41. jobo0502 Lv 1 42 pts. 9,126
  2. Avatar for gitwut 42. gitwut Lv 1 41 pts. 9,113
  3. Avatar for Skippysk8s 43. Skippysk8s Lv 1 40 pts. 9,092
  4. Avatar for Blipperman 44. Blipperman Lv 1 39 pts. 9,081
  5. Avatar for johnmitch 45. johnmitch Lv 1 38 pts. 9,067
  6. Avatar for Madde 46. Madde Lv 1 38 pts. 9,062
  7. Avatar for hansvandenhof 47. hansvandenhof Lv 1 37 pts. 9,062
  8. Avatar for drumpeter18yrs9yrs 48. drumpeter18yrs9yrs Lv 1 36 pts. 9,060
  9. Avatar for g_b 49. g_b Lv 1 35 pts. 9,054
  10. Avatar for Anfinsen_slept_here 50. Anfinsen_slept_here Lv 1 34 pts. 9,054

Comments