Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  6. Avatar for Deleted group 17. Deleted group pts. 6,257
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810

  1. Avatar for proteansoup 101. proteansoup Lv 1 7 pts. 8,551
  2. Avatar for ManVsYard 102. ManVsYard Lv 1 7 pts. 8,546
  3. Avatar for uihcv 103. uihcv Lv 1 6 pts. 8,545
  4. Avatar for Mike Cassidy 104. Mike Cassidy Lv 1 6 pts. 8,544
  5. Avatar for 01010011111 105. 01010011111 Lv 1 6 pts. 8,540
  6. Avatar for Merf 106. Merf Lv 1 6 pts. 8,539
  7. Avatar for arginia 107. arginia Lv 1 6 pts. 8,527
  8. Avatar for temandocorreo 108. temandocorreo Lv 1 5 pts. 8,494
  9. Avatar for bx7gn 109. bx7gn Lv 1 5 pts. 8,479
  10. Avatar for Argantyr 110. Argantyr Lv 1 5 pts. 8,477

Comments