Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847

  1. Avatar for proteansoup 101. proteansoup Lv 1 7 pts. 8,551
  2. Avatar for ManVsYard 102. ManVsYard Lv 1 7 pts. 8,546
  3. Avatar for uihcv 103. uihcv Lv 1 6 pts. 8,545
  4. Avatar for Mike Cassidy 104. Mike Cassidy Lv 1 6 pts. 8,544
  5. Avatar for 01010011111 105. 01010011111 Lv 1 6 pts. 8,540
  6. Avatar for Merf 106. Merf Lv 1 6 pts. 8,539
  7. Avatar for arginia 107. arginia Lv 1 6 pts. 8,527
  8. Avatar for temandocorreo 108. temandocorreo Lv 1 5 pts. 8,494
  9. Avatar for bx7gn 109. bx7gn Lv 1 5 pts. 8,479
  10. Avatar for Argantyr 110. Argantyr Lv 1 5 pts. 8,477

Comments