Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for ivalnic 121. ivalnic Lv 1 3 pts. 8,357
  2. Avatar for Arne Heessels 122. Arne Heessels Lv 1 3 pts. 8,345
  3. Avatar for bcd 123. bcd Lv 1 3 pts. 8,326
  4. Avatar for momadoc 124. momadoc Lv 1 3 pts. 8,310
  5. Avatar for Vmou 125. Vmou Lv 1 3 pts. 8,256
  6. Avatar for Altercomp 126. Altercomp Lv 1 3 pts. 8,249
  7. Avatar for Bo Peponis 127. Bo Peponis Lv 1 3 pts. 8,245
  8. Avatar for senor pit 128. senor pit Lv 1 3 pts. 8,234
  9. Avatar for dbuske 129. dbuske Lv 1 3 pts. 8,227
  10. Avatar for dtomp98 130. dtomp98 Lv 1 2 pts. 8,210

Comments