Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847
  1. Avatar for ivalnic 121. ivalnic Lv 1 3 pts. 8,357
  2. Avatar for Arne Heessels 122. Arne Heessels Lv 1 3 pts. 8,345
  3. Avatar for bcd 123. bcd Lv 1 3 pts. 8,326
  4. Avatar for momadoc 124. momadoc Lv 1 3 pts. 8,310
  5. Avatar for Vmou 125. Vmou Lv 1 3 pts. 8,256
  6. Avatar for Altercomp 126. Altercomp Lv 1 3 pts. 8,249
  7. Avatar for Bo Peponis 127. Bo Peponis Lv 1 3 pts. 8,245
  8. Avatar for senor pit 128. senor pit Lv 1 3 pts. 8,234
  9. Avatar for dbuske 129. dbuske Lv 1 3 pts. 8,227
  10. Avatar for dtomp98 130. dtomp98 Lv 1 2 pts. 8,210

Comments