Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for smholst 141. smholst Lv 1 2 pts. 7,981
  2. Avatar for demeter900 142. demeter900 Lv 1 2 pts. 7,979
  3. Avatar for FelixHelix 143. FelixHelix Lv 1 2 pts. 7,960
  4. Avatar for martinf 144. martinf Lv 1 1 pt. 7,954
  5. Avatar for DrTree 145. DrTree Lv 1 1 pt. 7,953
  6. Avatar for wyattj 146. wyattj Lv 1 1 pt. 7,941
  7. Avatar for brgreening 147. brgreening Lv 1 1 pt. 7,938
  8. Avatar for lamoille 148. lamoille Lv 1 1 pt. 7,927
  9. Avatar for joaniegirl 149. joaniegirl Lv 1 1 pt. 7,915
  10. Avatar for WhootWhoot 150. WhootWhoot Lv 1 1 pt. 7,883

Comments